| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50581233 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2150112 (CHEMBL5034574) |
|---|
| IC50 | 79±n/a nM |
|---|
| Citation |  Lee Walmsley, D; Murray, JB; Dokurno, P; Massey, AJ; Benwell, K; Fiumana, A; Foloppe, N; Ray, S; Smith, J; Surgenor, AE; Edmonds, T; Demarles, D; Burbridge, M; Cruzalegui, F; Kotschy, A; Hubbard, RE Fragment-Derived Selective Inhibitors of Dual-Specificity Kinases DYRK1A and DYRK1B. J Med Chem64:8971-8991 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50581233 |
|---|
| n/a |
|---|
| Name | BDBM50581233 |
|---|
| Synonyms: | CHEMBL5091510 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15N5OS |
|---|
| Mol. Mass. | 337.399 |
|---|
| SMILES | Cc1nc(OCc2ccsc2)c2c(c[nH]c2n1)-c1ccnc(N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
