Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM192 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302271 (CHEMBL830291) |
---|
Ki | 0.07±n/a nM |
---|
Citation | Huang, PP; Randolph, JT; Klein, LL; Vasavanonda, S; Dekhtyar, T; Stoll, VS; Kempf, DJ Synthesis and antiviral activity of P1' arylsulfonamide azacyclic urea HIV protease inhibitors. Bioorg Med Chem Lett14:4075-8 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM192 |
---|
n/a |
---|
Name | BDBM192 |
Synonyms: | (5R,6R)-1,5-dibenzyl-6-hydroxy-2,4-bis[(4-hydroxyphenyl)methyl]-1,2,4-triazepan-3-one | (5R,6R)-2,4-Bis(4-hydroxybenzyl)-1,5-dibenzyl-6-hydroxy-3-oxo-1,2,4-triazacycloheptane | CHEMBL130078 | Unnamed azacyclic urea |
Type | n/a |
Emp. Form. | C32H33N3O4 |
Mol. Mass. | 523.6221 |
SMILES | O[C@@H]1CN(Cc2ccccc2)N(Cc2ccc(O)cc2)C(=O)N(Cc2ccc(O)cc2)[C@@H]1Cc1ccccc1 |r| |
Structure |
|