Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50150033 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302271 (CHEMBL830291) |
---|
Ki | 1.37±n/a nM |
---|
Citation | Huang, PP; Randolph, JT; Klein, LL; Vasavanonda, S; Dekhtyar, T; Stoll, VS; Kempf, DJ Synthesis and antiviral activity of P1' arylsulfonamide azacyclic urea HIV protease inhibitors. Bioorg Med Chem Lett14:4075-8 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50150033 |
---|
n/a |
---|
Name | BDBM50150033 |
Synonyms: | (5R,6R)-1-Benzenesulfonyl-5-benzyl-6-hydroxy-2,4-bis-(4-hydroxy-benzyl)-[1,2,4]triazepan-3-one | CHEMBL183451 |
Type | Small organic molecule |
Emp. Form. | C31H31N3O6S |
Mol. Mass. | 573.659 |
SMILES | O[C@@H]1CN(N(Cc2ccc(O)cc2)C(=O)N(Cc2ccc(O)cc2)[C@@H]1Cc1ccccc1)S(=O)(=O)c1ccccc1 |
Structure |
|