| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50590778 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2197773 (CHEMBL5110289) |
|---|
| Ki | 3.3±n/a nM |
|---|
| Citation |  Zhuang, T; Xiong, J; Ren, X; Liang, L; Qi, Z; Zhang, S; Du, W; Chen, Y; Liu, X; Zhang, G Benzylaminofentanyl derivates: Discovery of bifunctional ? opioid and ? Eur J Med Chem241:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50590778 |
|---|
| n/a |
|---|
| Name | BDBM50590778 |
|---|
| Synonyms: | CHEMBL5182393 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N2O |
|---|
| Mol. Mass. | 350.4971 |
|---|
| SMILES | CCC(=O)N(CCc1ccccc1)C1CCN(Cc2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
