| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 3 |
|---|
| Ligand | BDBM50168727 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_306601 (CHEMBL832205) |
|---|
| IC50 | 170±n/a nM |
|---|
| Citation |  Bakshi, RK; Hong, Q; Olson, JT; Ye, Z; Sebhat, IK; Weinberg, DH; MacNeil, T; Kalyani, RN; Tang, R; Martin, WJ; Strack, A; McGowan, E; Tamvakopoulos, C; Miller, RR; Stearns, RA; Tang, W; Maclntyre, DE; van der Ploeg, LH; Patchett, AA; Nargund, RP 1-Amino-1,2,3,4-tetrahydronaphthalene-2-carboxylic acid as a Tic mimetic: application in the synthesis of potent human melanocortin-4 receptor selective agonists. Bioorg Med Chem Lett15:3430-3 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 3 |
|---|
| Name: | Melanocortin receptor 3 |
|---|
| Synonyms: | MC3-R | MC3R | MC3R_HUMAN | Melanocortin MC3 | Melanocortin receptor (M3 and M4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36044.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41968 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
|
|
|
|---|
| BDBM50168727 |
|---|
| n/a |
|---|
| Name | BDBM50168727 |
|---|
| Synonyms: | 1-[(R)-2-[((1S,2S)-1-Amino-1-methyl-1,2,3,4-tetrahydro-naphthalene-2-carbonyl)-amino]-3-(4-chloro-phenyl)-propionyl]-4-cyclohexyl-piperidine-4-carboxylic acid tert-butylamide | CHEMBL360819 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H51ClN4O3 |
|---|
| Mol. Mass. | 635.279 |
|---|
| SMILES | CC(C)(C)NC(=O)C1(CCN(CC1)C(=O)[C@@H](Cc1ccc(Cl)cc1)NC(=O)[C@H]1CCc2ccccc2[C@@]1(C)N)C1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
