Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50186426 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2219696 (CHEMBL5133030) |
---|
IC50 | 65300±n/a nM |
---|
Citation | Yang, L; Yang, C; Wang, L; Yang, Z; Guo, D; Fan, C Repurposing old drugs as novel inhibitors of human MIF from structural and functional analysis. Bioorg Med Chem Lett55:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50186426 |
---|
n/a |
---|
Name | BDBM50186426 |
Synonyms: | CHEMBL210858 | US10336721, ISO-1 | US10968198, ISO-1 | US8618147, ISO-1 | methyl 2-(3-(4-hydroxyphenyl)-4,5-dihydroisoxazol-5-yl)acetate |
Type | Small organic molecule |
Emp. Form. | C12H13NO4 |
Mol. Mass. | 235.2359 |
SMILES | COC(=O)CC1CC(=NO1)c1ccc(O)cc1 |c:7| |
Structure |
|