Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM50158336
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304341
pH7.4±n/a
EC50>10000±n/a nM
Commentsextracted
Citation Albert RHinterding KBrinkmann VGuerini DMüller-Hartwieg CKnecht HSimeon CStreiff MWagner TWelzenbach KZécri FZollinger MCooke NFrancotte E Novel immunomodulator FTY720 is phosphorylated in rats and humans to form a single stereoisomer. Identification, chemical proof, and biological characterization of the biologically active species and its enantiomer. J Med Chem 48:5373-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158336
n/a
NameBDBM50158336
Synonyms:2-(4-octylphenethyl)-2-aminopropane-1,3-diol | 2-Amino-2-[2-(4-octyl-phenyl)-ethyl]-propane-1,3-diol | 2-amino-2-(4-octylphenethyl)propane-1,3-diol | 2-amino-2-(4-octylphenyl)ethylpropane-1,3-diol | CHEMBL314854 | FINGOLIMOD | FINGOLIMOD HYDROCHLORIDE
TypeSmall organic molecule
Emp. Form.C19H33NO2
Mol. Mass.307.4708
SMILESCCCCCCCCc1ccc(CCC(N)(CO)CO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: