Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50158336 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_304342 (CHEMBL839768) |
---|
pH | 7.4±n/a |
---|
EC50 | >10000±n/a nM |
---|
Comments | extracted |
---|
Citation | Albert, R; Hinterding, K; Brinkmann, V; Guerini, D; Müller-Hartwieg, C; Knecht, H; Simeon, C; Streiff, M; Wagner, T; Welzenbach, K; Zécri, F; Zollinger, M; Cooke, N; Francotte, E Novel immunomodulator FTY720 is phosphorylated in rats and humans to form a single stereoisomer. Identification, chemical proof, and biological characterization of the biologically active species and its enantiomer. J Med Chem48:5373-7 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50158336 |
---|
n/a |
---|
Name | BDBM50158336 |
Synonyms: | 2-(4-octylphenethyl)-2-aminopropane-1,3-diol | 2-Amino-2-[2-(4-octyl-phenyl)-ethyl]-propane-1,3-diol | 2-amino-2-(4-octylphenethyl)propane-1,3-diol | 2-amino-2-(4-octylphenyl)ethylpropane-1,3-diol | CHEMBL314854 | FINGOLIMOD | FINGOLIMOD HYDROCHLORIDE |
Type | Small organic molecule |
Emp. Form. | C19H33NO2 |
Mol. Mass. | 307.4708 |
SMILES | CCCCCCCCc1ccc(CCC(N)(CO)CO)cc1 |
Structure |
|