Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-2 (COX-2)
LigandBDBM50173289
Substrate/Competitorn/a
Meas. Tech.ChEMBL_322407
IC50 2±n/a nM
Citation Toyokuni TKumar JSWalsh JCShapiro ATalley JJPhelps MEHerschman HRBarrio JRSatyamurthy N Synthesis of 4-(5-[18F]fluoromethyl-3-phenylisoxazol-4-yl)benzenesulfonamide, a new [18F]fluorinated analogue of valdecoxib, as a potential radiotracer for imaging cyclooxygenase-2 with positron emission tomography. Bioorg Med Chem Lett 15:4699-702 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclooxygenase-2 (COX-2)
Name:Prostaglandin G/H synthase (cyclooxygenase)
Synonyms:Cyclooxygenase-2 | Glucocorticoid-regulated inflammatory cyclooxygenase | Gripghs | Macrophage activation-associated marker protein P71/73 | PES-2 | PGH synthase 2 | PGHS-2 | PHS II | Prostaglandin G/H synthase (cyclooxygenase) | Prostaglandin H2 synthase 2 | Prostaglandin-endoperoxide synthase 2 | TIS10 protein
Type:Protein
Mol. Mass.:69020.39
Organism:Mus musculus (Mouse)
Description:Q05769
Residue:604
Sequence:
MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173289
n/a
NameBDBM50173289
Synonyms:2-Fluoro-4-(5-methyl-3-phenyl-isoxazol-4-yl)-benzenesulfonamide | CHEMBL363180
TypeSmall organic molecule
Emp. Form.C16H13FN2O3S
Mol. Mass.332.349
SMILESCc1onc(c1-c1ccc(c(F)c1)S(N)(=O)=O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: