Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP1 subtype |
---|
Ligand | BDBM50160917 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_354694 (CHEMBL870037) |
---|
Ki | 0.3±n/a nM |
---|
Citation | Hall, A; Bit, RA; Brown, SH; Chaignot, HM; Chessell, IP; Coleman, T; Giblin, GM; Hurst, DN; Kilford, IR; Lewell, XQ; Michel, AD; Mohamed, S; Naylor, A; Novelli, R; Skinner, L; Spalding, DJ; Tang, SP; Wilson, RJ Discovery of novel biaryl heterocyclic EP1 receptor antagonists. Bioorg Med Chem Lett16:2666-71 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP1 subtype |
---|
Name: | Prostaglandin E2 receptor EP1 subtype |
Synonyms: | PE2R1_HUMAN | PGE receptor, EP1 subtype | PTGER1 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP1 subtype | Prostaglandin E2 receptor EP1 subtype (EP1) | Prostanoid EP1 receptor |
Type: | Enzyme |
Mol. Mass.: | 41834.57 |
Organism: | Homo sapiens (Human) |
Description: | P34995 |
Residue: | 402 |
Sequence: | MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
|
|
|
BDBM50160917 |
---|
n/a |
---|
Name | BDBM50160917 |
Synonyms: | 3-(3-(2-(benzyloxy)-5-chlorophenyl)thiophen-2-yl)benzoic acid | 3-[3-(2-Benzyloxy-5-chloro-phenyl)-thiophen-2-yl]-benzoic acid | CHEMBL362543 |
Type | Small organic molecule |
Emp. Form. | C24H17ClO3S |
Mol. Mass. | 420.908 |
SMILES | OC(=O)c1cccc(c1)-c1sccc1-c1cc(Cl)ccc1OCc1ccccc1 |
Structure |
|