| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50186374 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_365586 (CHEMBL870940) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Shimamura, T; Shibata, J; Kurihara, H; Mita, T; Otsuki, S; Sagara, T; Hirai, H; Iwasawa, Y Identification of potent 5-pyrimidinyl-2-aminothiazole CDK4, 6 inhibitors with significant selectivity over CDK1, 2, 5, 7, and 9. Bioorg Med Chem Lett16:3751-4 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50186374 |
|---|
| n/a |
|---|
| Name | BDBM50186374 |
|---|
| Synonyms: | CHEMBL212049 | N-(5-(2-(cyclohexyloxy)-5-methylpyrimidin-4-yl)thiazol-2-yl)pyridin-2-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H21N5OS |
|---|
| Mol. Mass. | 367.468 |
|---|
| SMILES | Cc1cnc(OC2CCCCC2)nc1-c1cnc(Nc2ccccn2)s1 |
|---|
| Structure | 
|
|---|
Search and Browse
