| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50069984 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_353294 (CHEMBL861973) |
|---|
| Ki | 2.3±n/a nM |
|---|
| Citation |  Rydzewski, RM; Burrill, L; Mendonca, R; Palmer, JT; Rice, M; Tahilramani, R; Bass, KE; Leung, L; Gjerstad, E; Janc, JW; Pan, L Optimization of subsite binding to the beta5 subunit of the human 20S proteasome using vinyl sulfones and 2-keto-1,3,4-oxadiazoles: syntheses and cellular properties of potent, selective proteasome inhibitors. J Med Chem49:2953-68 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50069984 |
|---|
| n/a |
|---|
| Name | BDBM50069984 |
|---|
| Synonyms: | (R)-1-((S)-2-((S)-2-(benzyloxycarbonyl)-4-methylpentanamido)-4-methylpentanamido)-3-methylbutylboronic acid | CHEMBL114388 | Dipeptidyl boronic acid derivative |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H42BN3O6 |
|---|
| Mol. Mass. | 491.428 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1)B(O)O |
|---|
| Structure | 
|
|---|
Search and Browse
