Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50186928 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_376407 (CHEMBL866633) |
---|
EC50 | >10000±n/a nM |
---|
Citation | Yan, L; Huo, P; Doherty, G; Toth, L; Hale, JJ; Mills, SG; Hajdu, R; Keohane, CA; Rosenbach, MJ; Milligan, JA; Shei, GJ; Chrebet, G; Bergstrom, J; Card, D; Quackenbush, E; Wickham, A; Mandala, SM Discovery of 3-arylpropionic acids as potent agonists of sphingosine-1-phosphate receptor-1 (S1P1) with high selectivity against all other known S1P receptor subtypes. Bioorg Med Chem Lett16:3679-83 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50186928 |
---|
n/a |
---|
Name | BDBM50186928 |
Synonyms: | 6-(4-(5-(4-cyclohexylphenyl)-1,2,4-oxadiazol-3-yl)-3-methylphenyl)hexanoic acid | CHEMBL209008 |
Type | Small organic molecule |
Emp. Form. | C27H32N2O3 |
Mol. Mass. | 432.5546 |
SMILES | Cc1cc(CCCCCC(O)=O)ccc1-c1noc(n1)-c1ccc(cc1)C1CCCCC1 |
Structure |
|