Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50186923 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_376409 (CHEMBL866637) |
---|
EC50 | >10000±n/a nM |
---|
Citation | Yan, L; Huo, P; Doherty, G; Toth, L; Hale, JJ; Mills, SG; Hajdu, R; Keohane, CA; Rosenbach, MJ; Milligan, JA; Shei, GJ; Chrebet, G; Bergstrom, J; Card, D; Quackenbush, E; Wickham, A; Mandala, SM Discovery of 3-arylpropionic acids as potent agonists of sphingosine-1-phosphate receptor-1 (S1P1) with high selectivity against all other known S1P receptor subtypes. Bioorg Med Chem Lett16:3679-83 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50186923 |
---|
n/a |
---|
Name | BDBM50186923 |
Synonyms: | 3-(4-(5-(4-methoxy-3-(trifluoromethyl)phenyl)-1,2,4-oxadiazol-3-yl)-3-methylphenyl)propanoic acid | CHEMBL211806 |
Type | Small organic molecule |
Emp. Form. | C20H17F3N2O4 |
Mol. Mass. | 406.3552 |
SMILES | COc1ccc(cc1C(F)(F)F)-c1nc(no1)-c1ccc(CCC(O)=O)cc1C |
Structure |
|