Reaction Details |
| Report a problem with these data |
Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
---|
Ligand | BDBM50190536 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_373621 (CHEMBL869761) |
---|
Ki | 23000±n/a nM |
---|
Citation | Nguyen, C; Ruda, GF; Schipani, A; Kasinathan, G; Leal, I; Musso-Buendia, A; Kaiser, M; Brun, R; Ruiz-Pérez, LM; Sahlberg, BL; Johansson, NG; Gonzalez-Pacanowska, D; Gilbert, IH Acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. J Med Chem49:4183-95 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Deoxyuridine 5'-triphosphate nucleotidohydrolase |
---|
Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
Synonyms: | dUTP pyrophosphatase |
Type: | Protein |
Mol. Mass.: | 19574.43 |
Organism: | Plasmodium falciparum |
Description: | Q8II92 |
Residue: | 173 |
Sequence: | MHLKIVCLSDEVREMYKNHKTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIKAIALQYKS
NYYYKCEKSENKKKDDDKSNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAAL
DNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELDETSRGEGGFGSTSNNKY
|
|
|
BDBM50190536 |
---|
n/a |
---|
Name | BDBM50190536 |
Synonyms: | 1-[2-(azidomethyl)-4-(trityloxy)butyl]uracil | CHEMBL209757 |
Type | Small organic molecule |
Emp. Form. | C28H27N5O3 |
Mol. Mass. | 481.5457 |
SMILES | [N-]=[N+]=NCC(CCOC(c1ccccc1)(c1ccccc1)c1ccccc1)Cn1ccc(=O)[nH]c1=O |
Structure |
|