Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
LigandBDBM50190556
Substrate/Competitorn/a
Meas. Tech.ChEMBL_373622
Ki 1400±n/a nM
Citation Nguyen CRuda GFSchipani AKasinathan GLeal IMusso-Buendia AKaiser MBrun RRuiz-Pérez LMSahlberg BLJohansson NGGonzalez-Pacanowska DGilbert IH Acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. J Med Chem 49:4183-95 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
Name:Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
Synonyms:Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase
Type:Enzyme
Mol. Mass.:26574.03
Organism:Homo sapiens (Human)
Description:P33316
Residue:252
Sequence:
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50190556
n/a
NameBDBM50190556
Synonyms:1-(3-tritylaminopropyl)uracil | CHEMBL211905
TypeSmall organic molecule
Emp. Form.C26H25N3O2
Mol. Mass.411.4956
SMILESO=c1ccn(CCCNC(c2ccccc2)(c2ccccc2)c2ccccc2)c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: