| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50191511 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_377001 (CHEMBL868557) |
|---|
| IC50 | 2000±n/a nM |
|---|
| Citation |  Hirashima, S; Suzuki, T; Ishida, T; Noji, S; Yata, S; Ando, I; Komatsu, M; Ikeda, S; Hashimoto, H Benzimidazole derivatives bearing substituted biphenyls as hepatitis C virus NS5B RNA-dependent RNA polymerase inhibitors: structure-activity relationship studies and identification of a potent and highly selective inhibitor JTK-109. J Med Chem49:4721-36 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50191511 |
|---|
| n/a |
|---|
| Name | BDBM50191511 |
|---|
| Synonyms: | 2-{4-[4'-chloro-4-(2-oxo-pyrrolidin-1-yl)-biphenyl-2-ylmethoxy]-2-fluoro-phenyl}-1-cyclohexyl-1H-benzoimidazole-5-carboxylic acid | 2-{4-[4'-chloro-4-(2-oxopyrrolidin-1-yl)biphenyl-2-ylmethoxy]-2-fluorophenyl}-1-cyclohexyl-1H-benzimidazole-5-carboxylic acid | CHEMBL210297 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H33ClFN3O4 |
|---|
| Mol. Mass. | 638.127 |
|---|
| SMILES | OC(=O)c1ccc2n(C3CCCCC3)c(nc2c1)-c1ccc(OCc2cc(ccc2-c2ccc(Cl)cc2)N2CCCC2=O)cc1F |
|---|
| Structure | 
|
|---|
Search and Browse
