Reaction Details |
| Report a problem with these data |
Target | RNA-directed RNA polymerase |
---|
Ligand | BDBM50191514 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_376990 (CHEMBL866684) |
---|
IC50 | 53±n/a nM |
---|
Citation | Hirashima, S; Suzuki, T; Ishida, T; Noji, S; Yata, S; Ando, I; Komatsu, M; Ikeda, S; Hashimoto, H Benzimidazole derivatives bearing substituted biphenyls as hepatitis C virus NS5B RNA-dependent RNA polymerase inhibitors: structure-activity relationship studies and identification of a potent and highly selective inhibitor JTK-109. J Med Chem49:4721-36 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RNA-directed RNA polymerase |
---|
Name: | RNA-directed RNA polymerase |
Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
Type: | Protein |
Mol. Mass.: | 25173.95 |
Organism: | Hepatitis C virus |
Description: | Q8JXU8 |
Residue: | 229 |
Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
BDBM50191514 |
---|
n/a |
---|
Name | BDBM50191514 |
Synonyms: | 2-{4-[2-(4-chlorophenyl)pyridin-3-ylmethoxy]phenyl}-1-cyclohexyl-1H-benzimidazole-5-carboxylic acid | CHEMBL212582 |
Type | Small organic molecule |
Emp. Form. | C32H28ClN3O3 |
Mol. Mass. | 538.036 |
SMILES | OC(=O)c1ccc2n(C3CCCCC3)c(nc2c1)-c1ccc(OCc2cccnc2-c2ccc(Cl)cc2)cc1 |
Structure |
|