Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA polymerase gamma subunit 1
LigandBDBM50191511
Substrate/Competitorn/a
Meas. Tech.ChEMBL_377005
IC50>10000±n/a nM
Citation Hirashima SSuzuki TIshida TNoji SYata SAndo IKomatsu MIkeda SHashimoto H Benzimidazole derivatives bearing substituted biphenyls as hepatitis C virus NS5B RNA-dependent RNA polymerase inhibitors: structure-activity relationship studies and identification of a potent and highly selective inhibitor JTK-109. J Med Chem 49:4721-36 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA polymerase gamma subunit 1
Name:DNA polymerase gamma subunit 1
Synonyms:DNA Polymerase gamma | DNA nucleotidylexotransferase | DNA polymerase (alpha/delta/epsilon) | DNA polymerase beta | DNA polymerase delta subunit 1 | DNA polymerase eta | DNA polymerase iota | DNA polymerase kappa | DNA polymerase lambda | DNA polymerase subunit gamma-1 | DNA-directed DNA/RNA polymerase mu | Mitochondrial DNA polymerase catalytic subunit | PolG-alpha
Type:Enzyme Subunit
Mol. Mass.:139566.98
Organism:Homo sapiens (Human)
Description:Enzyme was purchased from Ulrich Hubscher, University of Zurich-Irchel, Switzerland.
Residue:1239
Sequence:
MSRLLWRKVAGATVGPGPVPAPGRWVSSSVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQ
VLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPL
PDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP
EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLS
PADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMA
ISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSLAEVH
RLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPH
PVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYK
EDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQ
QDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTP
KLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHC
LEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALT
ARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQ
AGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAI
LPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAA
VLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQP
FAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWI
SLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCIS
RALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYL
VREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTP
SNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50191511
n/a
NameBDBM50191511
Synonyms:2-{4-[4'-chloro-4-(2-oxo-pyrrolidin-1-yl)-biphenyl-2-ylmethoxy]-2-fluoro-phenyl}-1-cyclohexyl-1H-benzoimidazole-5-carboxylic acid | 2-{4-[4'-chloro-4-(2-oxopyrrolidin-1-yl)biphenyl-2-ylmethoxy]-2-fluorophenyl}-1-cyclohexyl-1H-benzimidazole-5-carboxylic acid | CHEMBL210297
TypeSmall organic molecule
Emp. Form.C37H33ClFN3O4
Mol. Mass.638.127
SMILESOC(=O)c1ccc2n(C3CCCCC3)c(nc2c1)-c1ccc(OCc2cc(ccc2-c2ccc(Cl)cc2)N2CCCC2=O)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: