Reaction Details |
| Report a problem with these data |
Target | Gonadotropin-releasing hormone receptor |
---|
Ligand | BDBM50133848 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_411226 (CHEMBL910612) |
---|
IC50 | 1900±n/a nM |
---|
Citation | Betz, SF; Lio, FM; Gao, Y; Reinhart, GJ; Guo, Z; Mesleh, MF; Zhu, YF; Struthers, RS Determination of the binding mode of thienopyrimidinedione antagonists to the human gonadotropin releasing hormone receptor using structure-activity relationships, site-directed mutagenesis, and homology modeling. J Med Chem49:6170-6 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gonadotropin-releasing hormone receptor |
---|
Name: | Gonadotropin-releasing hormone receptor |
Synonyms: | GNRHR | GNRHR_HUMAN | GRHR | GnRH receptor | GnRH-R | Gonadotropin releasing hormone 1 (GnRHR1) | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH) |
Type: | Enzyme |
Mol. Mass.: | 37749.45 |
Organism: | Homo sapiens (Human) |
Description: | P30968 |
Residue: | 328 |
Sequence: | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
BDBM50133848 |
---|
n/a |
---|
Name | BDBM50133848 |
Synonyms: | 1-(2,6-Difluoro-benzyl)-5-[(methyl-phenethyl-amino)-methyl]-6-(4-nitro-phenyl)-3-phenyl-1H-thieno[2,3-d]pyrimidine-2,4-dione | 1-(2,6-difluorobenzyl)-5-((methyl(phenethyl)amino)methyl)-6-(4-nitrophenyl)-3-phenylthieno[2,3-d]pyrimidine-2,4(1H,3H)-dione | CHEMBL120260 |
Type | Small organic molecule |
Emp. Form. | C35H28F2N4O4S |
Mol. Mass. | 638.683 |
SMILES | CN(CCc1ccccc1)Cc1c(sc2n(Cc3c(F)cccc3F)c(=O)n(-c3ccccc3)c(=O)c12)-c1ccc(cc1)[N+]([O-])=O |
Structure |
|