| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50199862 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_441142 (CHEMBL891361) |
|---|
| Ki | 12.4±n/a nM |
|---|
| Citation |  Li, T; Jinsmaa, Y; Nedachi, M; Miyazaki, A; Tsuda, Y; Ambo, A; Sasaki, Y; Bryant, SD; Marczak, E; Li, Q; Swartzwelder, HS; Lazarus, LH; Okada, Y Transformation of mu-opioid receptor agonists into biologically potent mu-opioid receptor antagonists. Bioorg Med Chem15:1237-51 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50199862 |
|---|
| n/a |
|---|
| Name | BDBM50199862 |
|---|
| Synonyms: | (S)-2-allylamino-N-{6-[(S)-2-allylamino-3-(4-hydroxy-phenyl)-propionylamino]-hexyl}-3-(4-hydroxy-phenyl)-propionamide | CHEMBL232303 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H42N4O4 |
|---|
| Mol. Mass. | 522.6789 |
|---|
| SMILES | Oc1ccc(C[C@H](NCC=C)C(=O)NCCCCCCNC(=O)[C@H](Cc2ccc(O)cc2)NCC=C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
