| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50199867 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_441145 (CHEMBL891364) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Li, T; Jinsmaa, Y; Nedachi, M; Miyazaki, A; Tsuda, Y; Ambo, A; Sasaki, Y; Bryant, SD; Marczak, E; Li, Q; Swartzwelder, HS; Lazarus, LH; Okada, Y Transformation of mu-opioid receptor agonists into biologically potent mu-opioid receptor antagonists. Bioorg Med Chem15:1237-51 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50199867 |
|---|
| n/a |
|---|
| Name | BDBM50199867 |
|---|
| Synonyms: | (S)-2-allylamino-N-(5-{[(S)-2-allylamino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-propyl-amino}-3-oxo-3,4-dihydro-pyrazin-2-yl)-3-(4-hydroxy-2,6-dimethyl-phenyl)-N-propyl-propionamide | CHEMBL396506 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H52N6O5 |
|---|
| Mol. Mass. | 672.8567 |
|---|
| SMILES | CCCN(C(=O)[C@H](Cc1c(C)cc(O)cc1C)NCC=C)c1cnc(N(CCC)C(=O)[C@H](Cc2c(C)cc(O)cc2C)NCC=C)c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
