| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM50552392 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2294276 |
|---|
| Kd | 13±n/a nM |
|---|
| Citation |  Dimitrova, YN; Gutierrez, JA; Huard, K It's ok to be outnumbered - sub-stoichiometric modulation of homomeric protein complexes. RSC Med Chem14:22-46 (2023) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM50552392 |
|---|
| n/a |
|---|
| Name | BDBM50552392 |
|---|
| Synonyms: | CHEMBL4743779 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25N5O |
|---|
| Mol. Mass. | 423.5096 |
|---|
| SMILES | Cc1ccc(C)c(Cn2c(nc3ccc(cc23)-c2cnn(C)c2)C(O)c2ccncc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
