Reaction Details |
| Report a problem with these data |
Target | Chymase |
---|
Ligand | BDBM50208234 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_429291 (CHEMBL915852) |
---|
IC50 | 120±n/a nM |
---|
Citation | Greco, MN; Hawkins, MJ; Powell, ET; Almond, HR; de Garavilla, L; Hall, J; Minor, LK; Wang, Y; Corcoran, TW; Di Cera, E; Cantwell, AM; Savvides, SN; Damiano, BP; Maryanoff, BE Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase. J Med Chem50:1727-30 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymase |
---|
Name: | Chymase |
Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
Type: | Enzyme |
Mol. Mass.: | 27340.12 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 247 |
Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
BDBM50208234 |
---|
n/a |
---|
Name | BDBM50208234 |
Synonyms: | 1-(benzo[b]thiophen-3-yl)-2-(naphthalen-2-ylamino)-2-oxoethylphosphonic acid | CHEMBL223582 |
Type | Small organic molecule |
Emp. Form. | C20H16NO4PS |
Mol. Mass. | 397.384 |
SMILES | OP(O)(=O)C(C(=O)Nc1ccc2ccccc2c1)c1csc2ccccc12 |
Structure |
|