| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymase |
|---|
| Ligand | BDBM50208239 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_429291 (CHEMBL915852) |
|---|
| IC50 | 66±n/a nM |
|---|
| Citation |  Greco, MN; Hawkins, MJ; Powell, ET; Almond, HR; de Garavilla, L; Hall, J; Minor, LK; Wang, Y; Corcoran, TW; Di Cera, E; Cantwell, AM; Savvides, SN; Damiano, BP; Maryanoff, BE Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase. J Med Chem50:1727-30 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymase |
|---|
| Name: | Chymase |
|---|
| Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27340.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 247 |
|---|
| Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
|---|
| BDBM50208239 |
|---|
| n/a |
|---|
| Name | BDBM50208239 |
|---|
| Synonyms: | (E)-2-(4-fluorostyrylamino)-1-(5-chlorobenzo[b]thiophen-3-yl)-2-oxoethylphosphonic acid | CHEMBL222952 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H14ClFNO4PS |
|---|
| Mol. Mass. | 425.798 |
|---|
| SMILES | OP(O)(=O)C(C(=O)NC=Cc1ccc(F)cc1)c1csc2ccc(Cl)cc12 |w:9.9| |
|---|
| Structure | 
|
|---|
Search and Browse
