Reaction Details |
| Report a problem with these data |
Target | C-C chemokine receptor type 1 |
---|
Ligand | BDBM50210970 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_444183 (CHEMBL892291) |
---|
IC50 | 17±n/a nM |
---|
Citation | Xie, YF; Lake, K; Ligsay, K; Komandla, M; Sircar, I; Nagarajan, G; Li, J; Xu, K; Parise, J; Schneider, L; Huang, D; Liu, J; Dines, K; Sakurai, N; Barbosa, M; Jack, R Structure-activity relationships of novel, highly potent, selective, and orally active CCR1 antagonists. Bioorg Med Chem Lett17:3367-72 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C chemokine receptor type 1 |
---|
Name: | C-C chemokine receptor type 1 |
Synonyms: | C-C CKR-1 | C-C chemokine receptor type 1 (CCR1) | CC-CKR-1 | CCR-1 | CCR1 | CCR1_HUMAN | CD_antigen=CD191 | CMKBR1 | CMKR1 | HM145 | LD78 receptor | MIP-1alpha-R | Macrophage inflammatory protein 1-alpha receptor | RANTES-R | SCYAR1 |
Type: | Enzyme |
Mol. Mass.: | 41180.69 |
Organism: | Homo sapiens (Human) |
Description: | P32246 |
Residue: | 355 |
Sequence: | METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
|
|
|
BDBM50210970 |
---|
n/a |
---|
Name | BDBM50210970 |
Synonyms: | (R)-3-(2-(2-(4-(4-fluorobenzyl)-2-methylpiperazin-1-yl)-2-oxoethoxy)-5-chlorophenylamino)-4-(methylamino)cyclobut-3-ene-1,2-dione | CHEMBL231829 |
Type | Small organic molecule |
Emp. Form. | C25H26ClFN4O4 |
Mol. Mass. | 500.95 |
SMILES | CNc1c(Nc2cc(Cl)ccc2OCC(=O)N2CCN(Cc3ccc(F)cc3)C[C@H]2C)c(=O)c1=O |
Structure |
|