| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage inflammatory protein-1 alpha receptor |
|---|
| Ligand | BDBM50210977 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_444185 (CHEMBL892293) |
|---|
| IC50 | 20±n/a nM |
|---|
| Citation |  Xie, YF; Lake, K; Ligsay, K; Komandla, M; Sircar, I; Nagarajan, G; Li, J; Xu, K; Parise, J; Schneider, L; Huang, D; Liu, J; Dines, K; Sakurai, N; Barbosa, M; Jack, R Structure-activity relationships of novel, highly potent, selective, and orally active CCR1 antagonists. Bioorg Med Chem Lett17:3367-72 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage inflammatory protein-1 alpha receptor |
|---|
| Name: | Macrophage inflammatory protein-1 alpha receptor |
|---|
| Synonyms: | C-C chemokine receptor type 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 40846.87 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1281523 |
|---|
| Residue: | 355 |
|---|
| Sequence: | MEISNITETYPTTTEYDYGDSTPCQKTDVRAFGAGLLPPLYSFVFIIGVVGNILVILVLM
QHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDNWVFGDAMCKLLSGFYYLGLYSE
IFFIILLTIDRYLAIVHAVFSLRARTVTFGIITSIIIWALAILASIPALCFFKAQWEFTH
HTCSPHFPDESLKTWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPNEKKAKAVRL
IFAITLLFFLLWTPYNLTVFVSAFQDVLFTNQCEQSKQLDLAIQVTEVIAYTHCCVNPII
YVFVGERFRKYLRQLFQRHVAIPLAKWLPFFSVDQLERTSSLTPSTGEHELSGGF
|
|
|
|---|
| BDBM50210977 |
|---|
| n/a |
|---|
| Name | BDBM50210977 |
|---|
| Synonyms: | (R)-3-(2-(2-(4-(4-fluorobenzyl)-2-methylpiperazin-1-yl)-2-oxoethoxy)-5-chlorophenylamino)-4-aminocyclobut-3-ene-1,2-dione | CHEMBL232441 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24ClFN4O4 |
|---|
| Mol. Mass. | 486.923 |
|---|
| SMILES | C[C@@H]1CN(Cc2ccc(F)cc2)CCN1C(=O)COc1ccc(Cl)cc1Nc1c(N)c(=O)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
