Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA)
LigandBDBM50215692
Substrate/Competitorn/a
Meas. Tech.ChEMBL_456534
IC50 0.2±n/a nM
Citation Pfefferkorn JASong YSun KLMiller SRTrivedi BKChoi CSorenson RJBratton LDUnangst PCLarsen SDPoel TJCheng XMLee CErasga NAuerbach BAskew VDillon LHanselman JCLin ZLu GRobertson AOlsen KMertz TSekerke CPavlovsky AHarris MSBainbridge GCaspers NChen HEberstadt M Design and synthesis of hepatoselective, pyrrole-based HMG-CoA reductase inhibitors. Bioorg Med Chem Lett 17:4538-44 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA)
Name:HMG-CoA reductase
Synonyms:3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) reductase | HMG-CoA Reductase | HMG-CoA reductase (HMGR)
Type:Enzyme
Mol. Mass.:97477.10
Organism:Homo sapiens (Human)
Description:P04035
Residue:888
Sequence:
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT
QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI
SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV
LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215692
n/a
NameBDBM50215692
Synonyms:CHEMBL400874 | sodium (3R,5R)-7-(5-((4-cyanobenzyl)carbamoyl)-3-(4-fluorophenyl)-1-isopropyl-4-phenyl-1H-pyrrol-2-yl)-3,5-dihydroxyheptanoate
TypeSmall organic molecule
Emp. Form.C35H35FN3O5
Mol. Mass.596.6685
SMILESCC(C)n1c(CC[C@@H](O)C[C@@H](O)CC([O-])=O)c(c(c1C(=O)NCc1ccc(cc1)C#N)-c1ccccc1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: