Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50218171
Substrate/Competitorn/a
Meas. Tech.ChEMBL_457030
Ki 210±n/a nM
Citation Lafontaine JADay RFDibrino JHadcock JRHargrove DMLinhares MMartin KAMaurer TSNardone NATess DADasilva-Jardine P Discovery of potent and orally bioavailable heterocycle-based beta3-adrenergic receptor agonists, potential therapeutics for the treatment of obesity. Bioorg Med Chem Lett 17:5245-50 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50218171
n/a
NameBDBM50218171
Synonyms:(R)-2-(2-(4-(2-(methoxymethyl)oxazol-4-yl)phenoxy)ethylamino)-1-(pyridin-3-yl)ethanol | CHEMBL250559
TypeSmall organic molecule
Emp. Form.C20H23N3O4
Mol. Mass.369.4143
SMILESCOCc1nc(co1)-c1ccc(OCCNC[C@H](O)c2cccnc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: