| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 3 |
|---|
| Ligand | BDBM50220688 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_457385 (CHEMBL941904) |
|---|
| EC50 | 241±n/a nM |
|---|
| Citation |  Sebhat, IK; Lai, Y; Barakat, K; Ye, Z; Tang, R; Kalyani, RN; Vongs, A; Macneil, T; Weinberg, DH; Cabello, MA; Maroto, M; Teran, A; Fong, TM; Van der Ploeg, LH; Patchett, AA; Nargund, RP Melanocortin subtype 4 receptor agonists: structure-activity relationships about the 4-alkyl piperidine core. Bioorg Med Chem Lett17:5720-3 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 3 |
|---|
| Name: | Melanocortin receptor 3 |
|---|
| Synonyms: | MC3-R | MC3R | MC3R_HUMAN | Melanocortin MC3 | Melanocortin receptor (M3 and M4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36044.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41968 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
|
|
|
|---|
| BDBM50220688 |
|---|
| n/a |
|---|
| Name | BDBM50220688 |
|---|
| Synonyms: | (R)-N-((S)-1-(4-(tert-butylcarbamoyl)-4-(4,4-dimethylcyclohexyl)piperidin-1-yl)-3-(4-fluorophenyl)-1-oxopropan-2-yl)-4-methylpiperazine-2-carboxamide | CHEMBL249322 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H52FN5O3 |
|---|
| Mol. Mass. | 585.7961 |
|---|
| SMILES | CN1CCN[C@H](C1)C(=O)N[C@@H](Cc1ccc(F)cc1)C(=O)N1CCC(CC1)(C1CCC(C)(C)CC1)C(=O)NC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
