| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50190976 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_452173 (CHEMBL900285) |
|---|
| Ki | 86±n/a nM |
|---|
| Citation |  Tran, JA; Jiang, W; Tucci, FC; Fleck, BA; Wen, J; Sai, Y; Madan, A; Chen, TK; Markison, S; Foster, AC; Hoare, SR; Marks, D; Harman, J; Chen, CW; Arellano, M; Marinkovic, D; Bozigian, H; Saunders, J; Chen, C Design, synthesis, in vitro, and in vivo characterization of phenylpiperazines and pyridinylpiperazines as potent and selective antagonists of the melanocortin-4 receptor. J Med Chem50:6356-66 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50190976 |
|---|
| n/a |
|---|
| Name | BDBM50190976 |
|---|
| Synonyms: | (1S)-[2-{4-[2-methyl-3-(2-methoxy-4-chlorophenyl)propionyl]-1-piperazinyl}-5-(trifluoromethyl)phenyl]-3-methylbutylamine | 1-(4-(2-((S)-1-amino-3-methylbutyl)-4-(trifluoromethyl)phenyl)piperazin-1-yl)-3-(4-chloro-2-methoxyphenyl)-2-methylpropan-1-one | CHEMBL377231 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H35ClF3N3O2 |
|---|
| Mol. Mass. | 526.034 |
|---|
| SMILES | COc1cc(Cl)ccc1CC(C)C(=O)N1CCN(CC1)c1ccc(cc1[C@@H](N)CC(C)C)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
