Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 1
LigandBDBM50245472
Substrate/Competitorn/a
Meas. Tech.ChEMBL_512836
IC50>100000±n/a nM
Citation Hughes TVXu GWetter SKConnolly PJEmanuel SLKarnachi PPollack SRPandey NAdams MMoreno-Mazza SMiddleton SAGreenberger LM A novel 5-[1,3,4-oxadiazol-2-yl]-N-aryl-4,6-pyrimidine diamine having dual EGFR/HER2 kinase activity: design, synthesis, and biological activity. Bioorg Med Chem Lett 18:4896-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 1
Name:Cyclin-dependent kinase 1/G1/S-specific cyclin-D1
Synonyms:Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | p34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:34101.08
Organism:Homo sapiens (Human)
Description:P06493
Residue:297
Sequence:
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50245472
n/a
NameBDBM50245472
Synonyms:CHEMBL472545 | N-(4-Benzyloxy-3-chloro-phenyl)-5-[5-(2-morpholin-4-yl-ethyl)-[1,3,4]oxadiazol-2-yl]-pyrimidine-4,6-diamine
TypeSmall organic molecule
Emp. Form.C25H26ClN7O3
Mol. Mass.507.972
SMILESNc1ncnc(Nc2ccc(OCc3ccccc3)c(Cl)c2)c1-c1nnc(CCN2CCOCC2)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: