| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl2-associated agonist of cell death |
|---|
| Ligand | BDBM50254534 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_558766 (CHEMBL1019895) |
|---|
| IC50 | 6940±n/a nM |
|---|
| Citation |  Porter, J; Payne, A; de Candole, B; Ford, D; Hutchinson, B; Trevitt, G; Turner, J; Edwards, C; Watkins, C; Whitcombe, I; Davis, J; Stubberfield, C Tetrahydroisoquinoline amide substituted phenyl pyrazoles as selective Bcl-2 inhibitors. Bioorg Med Chem Lett19:230-3 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl2-associated agonist of cell death |
|---|
| Name: | Bcl2-associated agonist of cell death |
|---|
| Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18393.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_478760 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
|---|
| BDBM50254534 |
|---|
| n/a |
|---|
| Name | BDBM50254534 |
|---|
| Synonyms: | CHEMBL467229 | N,N-dibutyl-4-chloro-1-(2-((S)-3-(hydroxymethyl)-1,2,3,4-tetrahydroisoquinoline-2-carbonyl)phenyl)-5-methyl-1H-pyrazole-3-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H37ClN4O3 |
|---|
| Mol. Mass. | 537.093 |
|---|
| SMILES | CCCCN(CCCC)C(=O)c1nn(c(C)c1Cl)-c1ccccc1C(=O)N1Cc2ccccc2C[C@H]1CO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
