| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vasopressin V2 receptor |
|---|
| Ligand | BDBM50246890 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_560999 (CHEMBL1015239) |
|---|
| EC50 | 47±n/a nM |
|---|
| Citation |  Yea, CM; Allan, CE; Ashworth, DM; Barnett, J; Baxter, AJ; Broadbridge, JD; Franklin, RJ; Hampton, SL; Hudson, P; Horton, JA; Jenkins, PD; Penson, AM; Pitt, GR; Rivière, P; Robson, PA; Rooker, DP; Semple, G; Sheppard, A; Haigh, RM; Roe, MB New benzylureas as a novel series of potent, nonpeptidic vasopressin V2 receptor agonists. J Med Chem51:8124-34 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vasopressin V2 receptor |
|---|
| Name: | Vasopressin V2 receptor |
|---|
| Synonyms: | ADHR | AVPR V2 | AVPR2 | Antidiuretic hormone receptor | DIR | DIR3 | Renal-type arginine vasopressin receptor | V2R | V2R_HUMAN | VASOPRESSIN V2 | Vasopressin V2 receptor | Vasopressin receptor |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 40295.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30518 |
|---|
| Residue: | 371 |
|---|
| Sequence: | MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
|
|
|
|---|
| BDBM50246890 |
|---|
| n/a |
|---|
| Name | BDBM50246890 |
|---|
| Synonyms: | 1-(4-[3-(2,6-Difluorophenyl)ureidomethyl]benzoyl)-2,3,4,5-tetrahydro-1H-1-benzazepine | CHEMBL455718 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23F2N3O2 |
|---|
| Mol. Mass. | 435.4658 |
|---|
| SMILES | Fc1cccc(F)c1NC(=O)NCc1ccc(cc1)C(=O)N1CCCCc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
