Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 5
LigandBDBM50277185
Substrate/Competitorn/a
Meas. Tech.ChEMBL_540421
IC50 3.2±n/a nM
Citation Evindar GBernier SGKavarana MJDoyle ELorusso JKelley MSHalley KHutchings AWright ADSaha AKHannig GMorgan BAWestlin WF Synthesis and evaluation of alkoxy-phenylamides and alkoxy-phenylimidazoles as potent sphingosine-1-phosphate receptor subtype-1 agonists. Bioorg Med Chem Lett 19:369-72 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 5
Name:Sphingosine 1-phosphate receptor 5
Synonyms:Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41796.42
Organism:Homo sapiens (Human)
Description:n/a
Residue:398
Sequence:
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277185
n/a
NameBDBM50277185
Synonyms:(S)-2-amino-3-(2-fluoro-4-(octyloxy)phenylamino)-2-methyl-3-oxopropyl dihydrogen phosphate | CHEMBL474688
TypeSmall organic molecule
Emp. Form.C18H30FN2O6P
Mol. Mass.420.4128
SMILESCCCCCCCCOc1ccc(NC(=O)[C@@](C)(N)COP(O)(O)=O)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: