| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, heart |
|---|
| Ligand | BDBM50247970 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_566943 (CHEMBL964126) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Barf, T; Lehmann, F; Hammer, K; Haile, S; Axen, E; Medina, C; Uppenberg, J; Svensson, S; Rondahl, L; Lundbäck, T N-Benzyl-indolo carboxylic acids: Design and synthesis of potent and selective adipocyte fatty-acid binding protein (A-FABP) inhibitors. Bioorg Med Chem Lett19:1745-8 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, heart |
|---|
| Name: | Fatty acid-binding protein, heart |
|---|
| Synonyms: | FABP11 | FABP3 | FABPH_HUMAN | Fatty acid binding protein muscle | MDGI |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14858.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1463784 |
|---|
| Residue: | 133 |
|---|
| Sequence: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
|
|
|
|---|
| BDBM50247970 |
|---|
| n/a |
|---|
| Name | BDBM50247970 |
|---|
| Synonyms: | 9-(4-methylbenzyl)-2,3,4,9-tetrahydro-1H-carbazole-8-carboxylic acid | CHEMBL454404 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21NO2 |
|---|
| Mol. Mass. | 319.3969 |
|---|
| SMILES | Cc1ccc(Cn2c3CCCCc3c3cccc(C(O)=O)c23)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
