| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gonadotropin-releasing hormone receptor |
|---|
| Ligand | BDBM50257516 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_566054 (CHEMBL954319) |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Hauze, DB; Chengalvala, MV; Cottom, JE; Feingold, IB; Garrick, L; Green, DM; Huselton, C; Kao, W; Kees, K; Lundquist, JT; Mann, CW; Mehlmann, JF; Rogers, JF; Shanno, L; Wrobel, J; Pelletier, JC Small molecule antagonists of the gonadotropin-releasing hormone (GnRH) receptor: structure-activity relationships of small heterocyclic groups appended to the 2-phenyl-4-piperazinyl-benzimidazole template. Bioorg Med Chem Lett19:1986-90 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gonadotropin-releasing hormone receptor |
|---|
| Name: | Gonadotropin-releasing hormone receptor |
|---|
| Synonyms: | GNRHR | GNRHR_HUMAN | GRHR | GnRH receptor | GnRH-R | Gonadotropin releasing hormone 1 (GnRHR1) | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37749.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30968 |
|---|
| Residue: | 328 |
|---|
| Sequence: | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
|---|
| BDBM50257516 |
|---|
| n/a |
|---|
| Name | BDBM50257516 |
|---|
| Synonyms: | 2-(4-tert-butylphenyl)-4-(4-((1-ethyl-2-methyl-1H-imidazol-4-yl)methyl)piperazin-1-yl)-1H-benzo[d]imidazole | CHEMBL523711 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N6 |
|---|
| Mol. Mass. | 456.6256 |
|---|
| SMILES | CCn1cc(CN2CCN(CC2)c2cccc3[nH]c(nc23)-c2ccc(cc2)C(C)(C)C)nc1C |
|---|
| Structure | 
|
|---|
Search and Browse
