| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50281029 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_63804 |
|---|
| IC50 | 700±n/a nM |
|---|
| Citation |  Thompson, KR; Finke, PE; Shah, SK; Ashe, BM; Dahlgren, ME; Maycock, AL; Doherty, JB Inhibition of human leukocyte elastase. 6. Inhibition by 6-substituted penicillin esters. Bioorg Med Chem Lett3:2283-2288 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50281029 |
|---|
| n/a |
|---|
| Name | BDBM50281029 |
|---|
| Synonyms: | (2S,5R,6R)-3,3-Dimethyl-6-[methyl-(2,2,2-trifluoro-acetyl)-amino]-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid benzyl ester | CHEMBL72774 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19F3N2O6S |
|---|
| Mol. Mass. | 448.413 |
|---|
| SMILES | CN([C@H]1[C@@H]2N([C@@H](C(=O)OCc3ccccc3)C(C)(C)S2(=O)=O)C1=O)C(=O)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
