Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50281046 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_63804 |
---|
IC50 | 20000±n/a nM |
---|
Citation | Thompson, KR; Finke, PE; Shah, SK; Ashe, BM; Dahlgren, ME; Maycock, AL; Doherty, JB Inhibition of human leukocyte elastase. 6. Inhibition by 6-substituted penicillin esters. Bioorg Med Chem Lett3:2283-2288 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50281046 |
---|
n/a |
---|
Name | BDBM50281046 |
Synonyms: | (2S,5R,6S)-6-Methoxy-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid methyl ester | CHEMBL308355 |
Type | Small organic molecule |
Emp. Form. | C10H15NO6S |
Mol. Mass. | 277.294 |
SMILES | CO[C@@H]1[C@@H]2N([C@@H](C(=O)OC)C(C)(C)S2(=O)=O)C1=O |
Structure |
|