| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50281658 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_138886 |
|---|
| IC50 | >10±n/a nM |
|---|
| Citation |  Hristova-Kazmierski, MK; Horan, P; Davis, P; Yamamura, HI; Kramer, T; Horvath, R; Kazmierski, WM; Porreca, F; Hruby, VJ A new approach to enhance bioavailability of biologically active peptides: conjugation of a δ opioid agonist to β-cyclodextrin Bioorg Med Chem Lett3:831-834 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50281658 |
|---|
| n/a |
|---|
| Name | BDBM50281658 |
|---|
| Synonyms: | CHEMBL385504 | cyclodextrin analogue of cyclic [p-I-Phe4]-DPDPE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C92H147IN6O40S2 |
|---|
| Mol. Mass. | 2168.202 |
|---|
| SMILES | COCC1O[C@@H]2O[C@@H]3C(CNC(=O)[C@H]4NC(=O)[C@@H](Cc5ccc(I)cc5)NC(=O)CNC(=O)[C@H](NC(=O)[C@@H](N)Cc5ccc(O)cc5)C(C)(C)SSC4(C)C)O[C@H](O[C@@H]4C(COC)O[C@H](O[C@@H]5C(COC)O[C@H](O[C@@H]6C(COC)O[C@H](O[C@@H]7C(COC)O[C@@H](O[C@@H]8C(COC)O[C@H](O[C@H]1C(OC)C2OC)C(OC)C8OC)C(OC)C7OC)C(OC)C6OC)C(OC)C5OC)C(OC)C4OC)C(OC)C3OC |
|---|
| Structure | 
|
|---|
Search and Browse
