| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50282530 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_79795 (CHEMBL696055) |
|---|
| IC50 | 13±n/a nM |
|---|
| Citation |  Dorsselaer, VV; Schirlin, D; Tarnus, C; Taylor, DL; Tyms, AS; Weber, F; Baltzer, S; Remy, JM; Brennan, T; Janowick, D Increased antiviral activity of HIV protease inhibitors of the difluorostatone type bearing (R)-valinol derivatives as novel c-termini Bioorg Med Chem Lett4:1213-1218 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50282530 |
|---|
| n/a |
|---|
| Name | BDBM50282530 |
|---|
| Synonyms: | CHEMBL20135 | {(S)-1-[1-(4-Benzyloxy-benzyl)-3,3-difluoro-3-((S)-2-methyl-1-phenethyl-propylcarbamoyl)-2-oxo-propylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H49F2N3O6 |
|---|
| Mol. Mass. | 741.8625 |
|---|
| SMILES | CC(C)[C@H](CCc1ccccc1)NC(=O)C(F)(F)C(=O)C(Cc1ccc(OCc2ccccc2)cc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
