Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50285702 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79978 (CHEMBL874137) |
---|
Ki | 20±n/a nM |
---|
Citation | Randad, RS; Lubkowska, L; Bujacz, A; Naik, RH; Gulnik, SV; Yu, B; Silva, A; Munshi, S; Lynch, TM; Clanton, DJ; Bhat, TN; Erickson, JW Structure-based design of achiral anthranilamides as P2/P2′ surrogates for symmetry-based HIV protease inhibitors: design, synthesis, X-ray structure, enzyme inhibition and antiviral activity Bioorg Med Chem Lett5:2557-2562 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50285702 |
---|
n/a |
---|
Name | BDBM50285702 |
Synonyms: | Anthranilamide derivative | CHEMBL314408 |
Type | Small organic molecule |
Emp. Form. | C36H38N4O8 |
Mol. Mass. | 654.7089 |
SMILES | OCC(=O)Nc1ccccc1C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)c1ccccc1NC(=O)CO |
Structure |
|