| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50285908 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_79817 (CHEMBL695236) |
|---|
| IC50 | 7.6±n/a nM |
|---|
| Citation |  Kempf, DJ; Flentge, CA; Wideburg, NE; Saldivar, A; Vasavanonda, S; Norbeck, DW Evaluation of substituted benzamides as P2 ligands for symmetry-based inhibitors of HIV protease Bioorg Med Chem Lett5:2725-2728 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50285908 |
|---|
| n/a |
|---|
| Name | BDBM50285908 |
|---|
| Synonyms: | CHEMBL90139 | [(1S,3S,4S)-4-(3-Amino-4-hydroxy-benzoylamino)-1-benzyl-3-hydroxy-5-phenyl-pentyl]-carbamic acid tert-butyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H37N3O5 |
|---|
| Mol. Mass. | 519.6319 |
|---|
| SMILES | CC(C)(C)OC(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)c1ccc(O)c(N)c1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
