new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTAFR
LigandBDBM50286012
Substrate/Competitorn/a
Meas. Tech.ChEBML_155162
Ki 2.3±n/a nM
Citation Davidsen SKSummers JBSweeny DJHolms JHAlbert DHCarrera GMTapang PMagoc TJConway RGRhein DA Synthesis of active metabolites of indole pyrrolothiazole paf antagonists Bioorg Med Chem Lett 5:2909-2912 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
PTAFR
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39221.53
Organism:RAT
Description:PAF Platelet activating factor PTAFR RAT::P46002
Residue:341
Sequence:
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT
VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA
YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY
SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV
FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR
KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286012
n/a
NameBDBM50286012
Synonyms:3-{(R)-7-[1-Dimethylcarbamoyl-6-(4-fluoro-phenyl)-1H-indole-3-carbonyl]-1H-pyrrolo[1,2-c]thiazol-3-yl}-1-hydroxy-pyridinium | 6-(4-Fluoro-phenyl)-3-[(R)-3-(1-oxy-pyridin-3-yl)-1H-pyrrolo[1,2-c]thiazole-7-carbonyl]-indole-1-carboxylic acid dimethylamide | CHEMBL317745
TypeSmall organic molecule
Emp. Form.C29H23FN4O3S
Mol. Mass.526.581
SMILESCN(C)C(=O)n1cc(C(=O)c2ccn3[C@H](SCc23)c2ccc[n+]([O-])c2)c2ccc(cc12)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: