| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50290243 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_212716 |
|---|
| IC50 | 538±n/a nM |
|---|
| Citation |  Semple, JE; Minami, NK; Tamura, SY; Brunck, TK; Nutt, RF; Ripka, WC Rational design and synthesis of a novel, selective class of thrombin inhibitors: P1-argininal derivatives incorporating P3---P4 quaternary lactam dipeptide surrogates Bioorg Med Chem Lett7:2421-2426 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50290243 |
|---|
| n/a |
|---|
| Name | BDBM50290243 |
|---|
| Synonyms: | CHEMBL431782 | N-((S)-1-Carbamimidoyl-2-hydroxy-piperidin-3-yl)-2-(2-oxo-3-phenylmethanesulfonylamino-pyrrolidin-1-yl)-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H28N6O5S |
|---|
| Mol. Mass. | 452.528 |
|---|
| SMILES | NC(=N)N1CCC[C@H](NC(=O)CN2CCC(NS(=O)(=O)Cc3ccccc3)C2=O)C1O |
|---|
| Structure | 
|
|---|
Search and Browse
