| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50060080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_138751 (CHEMBL747924) |
|---|
| Ki | 28411±n/a nM |
|---|
| Citation |  Liao, S; Lin, J; Shenderovich, MD; Han, Y; Hasohata, K; Davis, P; Qiu, W; Porreca, F; Yamamura, HI; Hruby, VJ The stereochemical requirements of the novel δ-opioid selective dipeptide antagonist TMT-Tic Bioorg Med Chem Lett7:3049-3052 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50060080 |
|---|
| n/a |
|---|
| Name | BDBM50060080 |
|---|
| Synonyms: | 2-({2-[(R)-2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carbonyl}-amino)-propionic acid | CHEMBL485576 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20N2O4 |
|---|
| Mol. Mass. | 340.3731 |
|---|
| SMILES | N[C@@H](Cc1ccc(O)cc1)C(=O)N1Cc2ccccc2C[C@H]1C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
