| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM520 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_80094 |
|---|
| Ki | 0.015±n/a nM |
|---|
| Citation |  Kempf, DJ; Molla, A; Marsh, KC; Park, C; Rodrigues, AD; Korneyeva, M; Vasavanonda, S; McDonald, E; Flentge, CA; Muchmore, S; Wideburg, NE; Saldivar, A; Cooper, A; Kati, WM; Stewart, KD; Norbeck, DW Lack of stereospecificity in the binding of the P2 amino acid of ritonavir to HIV protease Bioorg Med Chem Lett7:699-704 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM520 |
|---|
| n/a |
|---|
| Name | BDBM520 |
|---|
| Synonyms: | 1,3-thiazol-5-ylmethyl N-[(2S,3S,5S)-3-hydroxy-5-[(2S)-3-methyl-2-{[methyl({[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl})carbamoyl]amino}butanamido]-1,6-diphenylhexan-2-yl]carbamate | ABT-538 | CHEMBL163 | Norvir | RTV | Ritonavir |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H48N6O5S2 |
|---|
| Mol. Mass. | 720.944 |
|---|
| SMILES | CC(C)[C@H](NC(=O)N(C)Cc1csc(n1)C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)OCc1cncs1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
