| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled receptor homolog US28 |
|---|
| Ligand | BDBM50027205 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_322135 (CHEMBL885194) |
|---|
| EC50 | 28800±n/a nM |
|---|
| Citation |  Hulshof, JW; Casarosa, P; Menge, WM; Kuusisto, LM; van der Goot, H; Smit, MJ; de Esch, IJ; Leurs, R Synthesis and structure-activity relationship of the first nonpeptidergic inverse agonists for the human cytomegalovirus encoded chemokine receptor US28. J Med Chem48:6461-71 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled receptor homolog US28 |
|---|
| Name: | G-protein coupled receptor homolog US28 |
|---|
| Synonyms: | Human herpesvirus 5 chemokine receptor | US28 | US28_HCMVA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 41070.46 |
|---|
| Organism: | Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) |
|---|
| Description: | ChEMBL_322135 |
|---|
| Residue: | 354 |
|---|
| Sequence: | MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITW
RRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVAMFASLC
FITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYL
EVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIF
WLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQ
ELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSRRETSSDTLSDEVCRVSQIIP
|
|
|
|---|
| BDBM50027205 |
|---|
| n/a |
|---|
| Name | BDBM50027205 |
|---|
| Synonyms: | 5-[4-Hydroxy-4-(4-methoxy-phenyl)-piperidin-1-yl]-2,2-diphenyl-pentanenitrile | CHEMBL141713 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H32N2O2 |
|---|
| Mol. Mass. | 440.5766 |
|---|
| SMILES | COc1ccc(cc1)C1(O)CCN(CCCC(C#N)(c2ccccc2)c2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
