| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50293838 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_572369 (CHEMBL1035270) |
|---|
| pH | 8.5±n/a |
|---|
| Ki | 182300±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Keough, DT; Hocková, D; Holý, A; Naesens, LM; Skinner-Adams, TS; Jersey, J; Guddat, LW Inhibition of hypoxanthine-guanine phosphoribosyltransferase by acyclic nucleoside phosphonates: a new class of antimalarial therapeutics. J Med Chem52:4391-9 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50293838 |
|---|
| n/a |
|---|
| Name | BDBM50293838 |
|---|
| Synonyms: | (2-(6-oxo-1,6,7,8-tetrahydropurin-9-yl)ethoxy)methylphosphonate | CHEMBL564977 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H13N4O5P |
|---|
| Mol. Mass. | 276.1864 |
|---|
| SMILES | OP(O)(=O)COCCN1CNc2c1nc[nH]c2=O |
|---|
| Structure | 
|
|---|
Search and Browse
