| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM50295872 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_578767 (CHEMBL1052340) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Akue-Gedu, R; Debiton, E; Ferandin, Y; Meijer, L; Prudhomme, M; Anizon, F; Moreau, P Synthesis and biological activities of aminopyrimidyl-indoles structurally related to meridianins. Bioorg Med Chem17:4420-4 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK-2 | ERT1 | Erk2 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | MK01_RAT | Mapk | Mapk1 | Mitogen-activated protein kinase 2 | Prkm1 | p42-MAPK |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41278.65 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in
E.coli. and activated by phosphorylation with MEK1 prior to purification. |
|---|
| Residue: | 358 |
|---|
| Sequence: | MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM50295872 |
|---|
| n/a |
|---|
| Name | BDBM50295872 |
|---|
| Synonyms: | 5-Iodo-4-(1-Methyl-1H-indol-3-yl)pyrimidin-2-amine | CHEMBL552324 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H11IN4 |
|---|
| Mol. Mass. | 350.1577 |
|---|
| SMILES | Cn1cc(-c2nc(N)ncc2I)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
